PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30147.m014474
Common NameLOC8269203, RCOM_1505570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family WRKY
Protein Properties Length: 164aa    MW: 18964.2 Da    PI: 9.9623
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30147.m014474genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1048e-3379137159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vk+s+fprsYY+Ct++gC+vkk+v+r++e+++vv++tYeg+H+h+
  30147.m014474  79 LDDGYRWRKYGQKTVKNSKFPRSYYKCTHNGCSVKKQVQRKSEEEEVVVTTYEGKHTHS 137
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.3E-3365137IPR003657WRKY domain
SuperFamilySSF1182904.71E-2971138IPR003657WRKY domain
PROSITE profilePS5081129.68974139IPR003657WRKY domain
SMARTSM007744.4E-3779138IPR003657WRKY domain
PfamPF031062.9E-2780136IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MANLRINFSG KDETRKVKAE LTGLQHLGVQ NISQEISGGS PRSSDIKVSS GKRDGDYDNK  60
KEITRHRYAF QTRSQVDILD DGYRWRKYGQ KTVKNSKFPR SYYKCTHNGC SVKKQVQRKS  120
EEEEVVVTTY EGKHTHSIET CTDNFEDILR HMQTHTLLSK RHAV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-2969140778Probable WRKY transcription factor 4
2lex_A6e-2969140778Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002511154.11e-121PREDICTED: probable WRKY transcription factor 75
SwissprotQ9FYA23e-46WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLB9RAC91e-120B9RAC9_RICCO; WRKY transcription factor, putative
STRINGPOPTR_0012s10290.15e-59(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.11e-43WRKY DNA-binding protein 75